TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R0LL85|R0LL85_ANAPL CKLF-like MARVEL transmembrane domain-containing protein 8 (Fragment) OS=Anas platyrhynchos GN=CMTM8 PE=4 SV=1
QEQPPRPRSHTVTTTSSSFTANLSASSSTLAYDREFLRTLPGLLMVAEIVLGLLVWTLIAGTEYFLYPAFGWVMFVAVFY
WVLTVFFLIIYMTMTYTRIPQVPWTTVGLCFNGSAFILYLIAAIVDASSVTKELDSHNYNSWAASSFFAFVVTSCYAGNT
YFSFISWRSRTLQ