TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R4KCA2|R4KCA2_CLOPA Uncharacterized protein OS=Clostridium pasteurianum BC1 GN=Clopa_3358 PE=4 SV=1
MNNTQAIIEGSKIAIQGVAVAGILAILKIVLDGLMDIGIQYIKAEKDKLIQQMGTDKYNAKRQLAVDIYNRVEQEFKGKI
GVSEDKLKTFDKYIAEKIPGISQEDIQHFRESITGDVNSKLLESGIIKPADVQKSAALQQAQAQSAQLIQENAALKQRLV
DIQNSATVQQAQ