TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R4KML0|R4KML0_9FIRM Phage holin protein (Holin_LLH) OS=Desulfotomaculum gibsoniae DSM 7213 GN=Desgi_4695 PE=4 SV=1
MEDKVIQISYDVLAVLIPALVALLFELIRRKLGTENLNKIAVQLETKQDLALLAVRFVEQVYKDAGGQAKFNEALEWLSA
RANEHGIKITADEARGLIEAALRELKDSFGEEWANLGKPAA