TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R7Q4B7|R7Q4B7_CHOCR Putative ATP synthase protein OS=Chondrus crispus GN=CHC_T00010146001 PE=4 SV=1
MPSVSGFISSVPVISGKLGLSKRLRATSFYFTRRPRLPAAPSTPSQRTIISANSLEESKRRARSQYDNIPDLNQRYISEL
GWVERKYGPKRLKKKIIKEAQQSILRPDGPSAPSASRTTKIEEPGSDGNGEADLEQYNRIRSELLVNTIFVGMLGFCVAW
GFGTVKEVQSFMMGLVGSMAYVYLLSRSVDRMATAARETGTMSGDALQPARLAILVLLVIASAKNSDKLSVLPVLFGFFT
YKVATLLPLLTGEAFE