TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R8YEH7|R8YEH7_ACIPI Type 4 prepilin-like proteins leader peptide-processing enzyme OS=Acinetobacter pittii ANC 4050 GN=F931_02543 PE=3 SV=1
MQDIIAYFIQNLSALYIAVALVSLCIGSFLNVVIYRTPKMMEQDWQQECQMLLNPEQPIIEHEKLTLSKPASSCPECHQP
IRWYQNIPVISWLMLRGKCGHCQHPISIRYPAVELLTMLCSLVVVMVFGPTLQMLWGLVLTWVLIALTFIDFDTQLLPDR
FTLPLAALGLGINTFNIYTSPNSAIWGYLIGFLCLWIVYYLFKVITGKEGMGYGDFKLLAALGAWMGPLMLPLIVLLSSL
LGAIIGIILLKLRNDNQPFAFGPYIAIAGWVAFLWGDQIMKIYLGG