TCDB is operated by the Saier Lab Bioinformatics Group
>tr|R9QT20|R9QT20_VITVI ABCC subfamily ATP-binding cassette protein OS=Vitis vinifera OX=29760 GN=ABCC1 PE=2 SV=1
MGDLWTMFCGEPSCLDSGGCSSEFIFFNHPSSCANHALTVCFDILLFVMFLFTMIQRTSSKPVHVPGQFQRFSPLQISSA
IFNGCLGLVYLCLGVWILEENLRKTQIVLPLHWWLLPLLQGFTWLLVGLMVSLRGQYLPRSPLRILSILAFLFSGITGVL
SIFSAIVYKEASVEIVLNVLSLPGAILLLLCAYKGYKYEETDKIVNGSGLYTPLNGEADGSAKTDSVGDVTPFAKAGFFS
SMSFWWLNPLMKRGTKKTLENEDIPKLREEDRAESCYLQFLEELIKQKQIEPSSQPSILRVIILCYWKDIFISGFFALVK
ILTLSTGPLLLNAFIKVAEGKELFKNEGYVLAMALLVSKNVESLSQRQWYFRSRLIGLRVRSLLTAAIYKKQLRLSNAAK
MIHSSGEITNYVTVDSYRIGEFPFWFHQTWTTSLQLCIVLVILFNILGLATFAALVVIILTVLCNAPLAKLQHKFQSKLM
VAQDERLRACSEALVNMKVLKLYAWENHFKNVIEKLRNVEYKWLSGVQLRKGYNGFLFWSSPVLVSAATFGACFFLGIPL
NASNVFTFVAALRLVQDPIRSIPDVIGVVIQAKVAFARIVKFLEAPELQTSNVRQKSNIENISNAISIKSANFSWEEKLS
KSTLRDISLEVRTGEKVAICGEVGSGKSTLLAAILGEIPDVQGTIRVYGRIAYVSQTAWIQTGSIQENILFGSSMDPERY
QATLEKCSLVKDLDLLPYGDLTEIGERGVNLSGGQKQRIQLARALYQDADIYLLDDPFSAVDAHTATSLFNEYVMDALSG
KTVLLVTHQVDFLPAFDSVLLMSDGEIIQAAPYQQLLVSSQEFVDLVNAHKETAGSERLAEVTPEKFENSVREINKTYTE
KQFKAPSGDQLIKQEEREIGDMGFKPYMQYLSQNKGYLFFSLAALSHILFVAGQISQNSWMAANVDNPNISTLQLIVVYL
LIGATSTLFLLSRALFVVALGLQSSKSLFTQLLNSLFRAPMSFYDSTPLGRILSRISNDLSIVDLDVPFSFVFAFGATTN
AYSNLGVLAVVTWQVPFVSIPMIYVAIRLQRYYFASAKELMRINGTTKSLVANHLAESIAGAMTIRAFEEEERFFVKNMD
FIDTNASPFFHSFAANEWLIQRLEALSAMVLSSSALCMILLPPGTFTAGFIGMAMSYGLSLNMSLVFSIQNQCILANYII
SVERLNQYMHIPSEAPEVIEGSRPPPNWPAVGRVDIHDLQIRYRPDTPLVLRGINCTFEGGHKIGIVGRTGSGKTTLIGA
LFRLVEPAGGKIIVDGIDISTIGLHDLRSHFGIIPQDPTLFNGTVRYNLDPLSQHTDHEIWEVLGKCQLQEAVQEKEEGL
GSIVAEGGSNWSMGQRQLFCLGRALLRRSRILVLDEATASIDNATDLILQKTIRTEFADCTVITVAHRIPTVMDCTMVLA
ISDGKLVEYDEPAKLMKREGSLFGQLVREYWSHFHSAESH