TCDB is operated by the Saier Lab Bioinformatics Group
>RDE35054.1 ABC transporter ATP-binding protein [Parageobacillus thermoglucosidasius]
MNNILTVKNITKRYRNGSGIHNVHFTVNQGEIVGLLGANGAGKTTTIRCCLGLLGPDTGSVTVGELPAGSPEALKSIAFI
SDNPNLYPLLTVEEHLYFRAKAFDLKGDIKTLVEAALQEVGLFEFATRIGGELSRGQRQRVILAGAVLQNASLYVLDEPT
AGLDPVSIQWLIDWLKVKAQQGAGVLVSTHNLDFLCKVATRVVVLSQGQVIREDMVPTEEEKFQHWQEQIVNLLKGERKD
D