TCDB is operated by the Saier Lab Bioinformatics Group
>RKT61468.1 surface antigen-like protein [Coprobacter fastidiosus NSB1]
MISKRIRLFNSNGQFHVMFSHLFKKRHSIEKKYLYFRGMNESSVCIFKLIIISLFGLVTILYPKISYAISQDSLINSQNK
KGWNVTPFPEIAYNSDLGFQYGIYCELYDFGNGENYPDYTHKFCIEAARFTKGSGVYWFFYDSPQLWKNHRFSFDVAYLP
DNMCDFYGYNGRSAPYSDTHNDSFYKIDRKQIRMIFGLQGKIVGQLNWMAGISWQKMMIQPVSLKKYIGADNLYNRYIKA
GLINQNEAKGGNVLQWKAGIVYDTRDREADPTQGIYGKAIFAFSPDWTSKNGYSFIRTTLNVCYYQSLWKEHLTLAGRIG
LQLTPVGRVPFYFLSDINTYYIRQTYSEGLGGTNNIRGVLRNRITGNGIGWTNIELRLRSRVIRLLKQNWYIGMNPFFDA
GAVLQPYRLKLQKESNDPIIYSGKNECLHTSAGIGLKLVMNHNFVLSAEWGAAFSREDGTNGIDLGINYLF