TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S6APG9|S6APG9_LOTJA MATE efflux family protein OS=Lotus japonicus GN=MATE PE=2 SV=1
MNDKSCSNNATKSKYKIPLSIFFKDARLVFKFDSLAKEILGIAFPSALAIAADPIASLIETAFIGHLGPVQLAAAGVAIA
LFNQASKVTIFPLVSITTSFVAEEDTLEKNNTTAMEKKPIENIMDKSKDVALPQDIEEYASEEKNETPTQVLAASVELIE
KSTEHETNNGDGTNTSNSNSGRKKRHISSASTALLFGLILGLIQAATLLFAAKPLLRVMGLKSNSPTLIPAEKYLKLRSL
GAPPMLLSLAMQGIFRGFKDTTTPLYVIVLGYSVKIALDPVLIYAFKWGLNGAAISHVFSQYMMALVLLLILLTKVVLMP
PSIKDLQFSRFLKNGGMLFAKVVAVTFCVTLAASLASRLGSIQMAAFQTCLQVWLTSSLLSDGLAIAVQAILASSFAEKD
YDKVVAATTRTLQMTLVLGLGLSLVGSCLYFGAGMFSESGPVVHLIRIAVPFVAATQPINALAFVFDGVNYGASDFAYSA
YSMVMVSFATIASLFLLYKSNGFIGIWIALTIYMTLRMFAGLFRMGTCSGPWRFLRGY