TCDB is operated by the Saier Lab Bioinformatics Group
>tr|S8G252|S8G252_TOXGO Transporter, major facilitator family protein OS=Toxoplasma gondii ME49 GN=TGME49_316280 PE=4 SV=1
MRSSSADESKSGAPLLGDQQDVENGAAAAEDPAQPAQRRKRFTCQELFWCPETGYQPGGRSAVLSTYTYAAVHGATDQLL
PASFKSLEIDLRLSPVGLGTASSCSRIAHAIACPLWGLAIDCCGRRRMFASTALGWGLASALFFFVWMPWQVMPLMCFTG
LFMAAMGPLSQKVLSEEVPAESRGTSFGTMHFFQSLGRIISLQAATSVSGLFILGAEGWRYAFAMCGLVSIVMAICLGLR
VPDSAEQKRLQKSSGVKWFSPKELLYVLWNGSFWSMLLVGILNGIPRSALNFCTMWFQYCGITDWWSSFIVSASWIAAMF
VAPFVGCLGDYASRLSRDHGRPLVAQISLILRSGLMAILLTCIPLQPSSFWIFLVLSVLIGFLAGWPGVGVNRPILSEIV
KPQHRATVFALVSTCEGIGAALLGAPLVGFLSQTVFGYISVDHSHKLVALTDLQRQSNARALSRAMLCMTVGPWIANVLV
YCILHKTYRKDRQLQTVFEDAPANAENRIDAAQQDVSCGDNRPQRYKSALS