TCDB is operated by the Saier Lab Bioinformatics Group
>SES17047.1 hypothetical protein SAMN05661109_02084 [Corynebacterium cystitidis DSM 20524]
MADAFETWNALSSTGLVGEFITFFENVGKWSGAASKLIGLASK