TCDB is operated by the Saier Lab Bioinformatics Group
>SET99644.1 O-antigen ligase [Paenibacillus sp. NFR01]
MNALMYLAFALLPLDNFPFMFGGAYKPVSLILIVLYFALHLPALLRLRFQRKEVWAFVILVSAALISALLGKEHGYASAG
LSDAVFSLAAGIVIYLSFKIFMDMNQEKPDAVLVLFRWMLRGYWLAVGIGLLQLVYIYAVPSGALRSLIGFFVHRDAYVT
TGRLHFTFSEPSYIGLHTNLLLFPAYLVLSKYGRLAKADKILVVLFVLLSLLSLSIRYYIDLLFFLLAYLVVTSTAKTFP
LLMLKLALIGAVFLVGLNTIFVRNVFHLNSDHYYRILHIYEDPASLANDNSFSIRSTYSQLGLASFLDRPLLGYGLGNFH
YGYLDNQDLIPAKTLEENEELRQAKTTLVLPQYNMYTRFLSEFGLPGILLFLTLLALIVQGHRGNFPRLIVILLLYALLQ
FDSFAFIQVLFWVAFLQHPFVSRLGIGKGEDPAAIGGNRDEKNLRHRPVSAPRPWAVQSAGDADPLPGVQRKIRIDLR