TCDB is operated by the Saier Lab Bioinformatics Group
>SHN80733.1 Uncharacterized conserved protein, contains PQ loop repeat [Geodermatophilus obscurus]
MTSPVIPAAIRLPLTDERPEPVCGCSARRWPRPSRPTRTEPRSTMIAALGSLAAALSITVVWPQVWLSCRHGRTLGLSPT
AGWLAVGLNLCWLTFGLLVGDAPQIATHAVVGAGNTAVLAALLLTRPHARSVRVLVRTAAGAAALAALVAGSVAAVLLGA
DAAPVASALAAVATVVGIVAALPQLVGILLDRSQDLSGMSPARWYLGTGSCASWTAYGWLLDQPTVWLSAGFGLVCAVAT
CVVLRTRRPAAPVAPVVRLCPAAAPRRALAAAA