TCDB is operated by the Saier Lab Bioinformatics Group
>SQI24628.1 Uncharacterised protein [Corynebacterium jeikeium]
MFDTNILDQLSTFFGGFSDIFGGLKDVLDTIFGWINGGAEK