TCDB is operated by the Saier Lab Bioinformatics Group
>SSC12738.1 protein of unknown function [Mesotoga infera]
MGTHFRENMKQNLKWVVPYLGLYCAMNYGFVAMPWKTSLMWGVIMLGLFIIQSVVDLRSHPEMKG