TCDB is operated by the Saier Lab Bioinformatics Group
>tr|T1T4Z8|T1T4Z8_ARATH GHR1 protein OS=Arabidopsis thaliana GN=GHR1 PE=2 SV=1
MNLSRILLLSMFFLSAMGQLPSQDIMALLEFKKGIKHDPTGFVLNSWNDESIDFNGCPSSWNGIVCNGGNVAGVVLDNLG
LTADADFSLFSNLTKLVKLSMSNNSLSGVLPNDLGSFKSLQFLDLSDNLFSSSLPKEIGRSVSLRNLSLSGNNFSGEIPE
SMGGLISLQSLDMSSNSLSGPLPKSLTRLNDLLYLNLSSNGFTGKMPRGFELISSLEVLDLHGNSIDGNLDGEFFLLTNA
SYVDISGNRLVTTSGKLLPGVSESIKHLNLSHNQLEGSLTSGFQLFQNLKVLDLSYNMLSGELPGFNYVYDLEVLKLSNN
RFSGSLPNNLLKGDSLLLTTLDLSGNNLSGPVSSIMSTTLHTLDLSSNSLTGELPLLTGGCVLLDLSNNQFEGNLTRWSK
WENIEYLDLSQNHFTGSFPDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEI
HLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLSGSLPSSMNDIVSLSSLDVSQNHFT
GPLPSNLSSNIMAFNVSYNDLSGTVPENLKNFPPPSFYPGNSKLVLPAGSPGSSASEASKNKSTNKLVKVVIIVSCAVAL
IILILVAILLFCICKSRRREERSITGKETNRRAQTIPSGSGGGMVVSAEDLVASRKGSSSEILSPDEKLAVATGFSPSKT
SNLSWSPGSGDSFPADQQLARLDVRSPDRLVGELHFLDDSIKLTPEELSRAPAEVLGRSSHGTSYRATLDNGVFLTVKWL
REGVAKQRKEFAKEVKKFSNIRHPNVVTLRGYYWGPTQHEKLILSDYISPGSLASFLYDRPGRKGPPLAWTQRLKIAVDV
ARGLNYLHFDRAVPHGNLKATNILLDGAELNARVADYCLHRLMTQAGTVEQILDAGILGYRAPELAASRKPLPSFKSDVY
AFGVILLEILTGRCAGDVITGEQEGVDLTDWVRLRVAEGRGAECFDSVLTQEMGSDPVTEKGMKEVLGIALRCIRSVSER
PGIKTIYEDLSSI