TCDB is operated by the Saier Lab Bioinformatics Group
>TGO20036.1 hypothetical protein BTUL_0001g00430 [Botrytis tulipae]
MPNQTRDYGDLRVTMTADYHWAWDNNKYGTHRGCTFWNPAPQGDMRTLGTVCVGKQNYWARNWRATILFGPKPNSTNPNP
AVKRPTDYTRLWWESNDHSWHMGSVWRPIAPAGYVALGDLMVNSIDKPSLDYLWCLRADLVKPANYWPADIWNDRGSGRS
TDISIWAVVPEAMGINGNAKIPLFADTFIHSNTYNPPHTGLAFVPVLDLGNEFQEFDQSVPTFTKTSIPNTGKTYAVVEQ
AAVTLPMRCFFYSEDPRTIAQIEKPFISISKAIAWYVEGVYENGGSGSFTREQRIKSGISTTQSETMEHQVGISITASHG
FKLAEMSVTLNYQFTHTQSTSFTEFTETEIMQRFEVLPHTCTVLFSKHVYMKGTMNNGGTILSEIEAVANEDVHLGGCKL