TCDB is operated by the Saier Lab Bioinformatics Group
>TMW43345.1 hypothetical protein DOY81_011576 [Sarcophaga bullata]
MISILLSRICILTFGTLYPGYISFKTVRAKVVDDYLKWMMYWIVFAIFTVMETFTDIFLTWLPFYYEIKMILIFWLLPTI
GNGSSFIYRNFIHRLLKNHEQRIDQYLERLREKGQDLILQYVKEAFLCVKQTILNVINRKLPNMMLAVLSNTANESDRSL
PEQSSVIIEEIEEQEMYLSNVIKPANRKETKKTSTKREETAVAARTSRSRMRKTRNPTQEN