TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U1KDR4|U1KDR4_PSEO7 Uncharacterized protein OS=Pseudoalteromonas piscicida JCM 20779 GN=PPIS_09583 PE=4 SV=1
MKSIKLKKSAIAIVTSLQLFGLSQLATANTDVPEISPIMYDTLQGDIEGAPLFVDVGSDDFLLTQEQWHTIQVFAQAAVG
LPNNESAFRSSTRYPDDTPLNNHYKALMETFGEINASGQNWNHNIYPNVIDLATKLANYSDTHALLINPFISQLTNLHNA
SLTGDMQAAEQSRQAAISFLNTFMSFIDSNLNKTEEVVNELISFQGGLTTHTGELETLESTFADILNKDQPANIREKIST
LQNRLNSLNNEKDTKLKIVAGLSAGGPLVLLIGGSVLGSQVEELKDEIDKVQAQIDSSNKDLAHSVSLAASYEIAKGQVD
GMNDKILKAIDNVRLVQVHWQSLLGDMRSLKEVLEQLDSENALRNANVVVAGIVSSPLASSATNSWKDISDKARAFLQNA
YLPISEQ