TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U1PW76|U1PW76_9ACTO Tat pathway signal sequence domain protein OS=Actinomyces johnsonii F0510 GN=HMPREF1549_01324 PE=4 SV=1
MTIAVVLLICVGVRRELAAALSVGDCVALVSIPITWTAVRNARRFSLMLMLSILAAGTAYIMSLLAESSFAVEAWARRVT
TLSLLAVPCAVAVFVWGARRLGVRRAALAVGFGMFLDSLSLFQTNPNPWKFGVGAAVSIMVLSFVANRRRLVQIVALLGL
SGVFLVSDSRSALAFLAIILGTVVWQALASWARWRVPTPRRLAVSQIAVLGVVGAVAMAGVVAASESGTLGEDAQNRTIA
QSSSSAGLLLSARPELGASWALFRNRPWGYGAGVKPRFDDLWVAKQGMAALGYDPDNGYVENFMFGGRIELHSGLMDMWA
AASIPGALLLLLIAGMALAAMMRDLGRLKATPWLFFAALTVVQNVFVGPWTVLPAYLPIVLGAAVLQPALRDAVPLGTDD
EPGSEPADDAATPSSVSGVQRETASEPGTRPEPESRTEAEPAQA