TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U3GK36|U3GK36_SALCE O-antigen polymerase OS=Salmonella choleraesuis GN=wzy PE=4 SV=1
MVIYLVLLIFIFSFSIVMMLNPSKRTANKFLGIYVLLLSLFAGLRFHTGWDWEAYDYFFNLLNQANIYDFFSYNIFNYEP
GFVLLSYISILLNIPPFLLFAIITVSLIVSSAHKYLGKFVPYIFCLIYLYYGYFHNFSIVRQGIAAALFAYSIRFLIVRS
YKFYFVIIFASLFHISAAMLLAIPLLLVIANRVPFFLLLLLSICMVLLPLSDMLGLKSLMSKIPALNIYLNNSTLSYKVG
FSLKYLELLIVFYCYYERKFFLPLINNFGIRQFWIFKGLIIIELMIYSIFNDYSIIYERLSVYFEFSHAIAIAMIVSTFK
YKRIQFFLMLILLFFVFARYYQLVYSPVRVPGEMSHLERFENYCSIFNERECQR