TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U3U8B0|U3U8B0_9ENTR Inner membrane protein YbhQ OS=Candidatus Pantoea carbekii GN=BMSBPS_0371 PE=4 SV=1
MKWFNLIYIITGKTCLYLSIRLSVIIAFIIGWKNNLLFEVGITLVLTYIIVFIIMIISQYNIRLRRINDSLEEVTTNYYF
STAMLILFLISRFIHNYALISFFGLVMLLGPTLFSIFVKTTNSYIEHH