TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U5MQD3|U5MQD3_CLOSA Uncharacterized protein OS=Clostridium saccharobutylicum DSM 13864 GN=CLSA_c06290 PE=4 SV=1
MYSSKLDQSIANPAGDTMGELNDLELGELAGAFSSRNICTAITESTYLTAICCSN