TCDB is operated by the Saier Lab Bioinformatics Group
>tr|U6IPJ7|U6IPJ7_HYMMI XK protein 6 OS=Hymenolepis microstoma GN=HmN_000487200 PE=4 SV=1
MDPRISPIKPHQGFRQLQRQSQRRYKPKADGHPVRYIPPSELRESTYVQNGSTESRRYDDLSTFVKQDQRERATSSSYIN
NNRQMSSRTSAASPVILNTHSDNAPYVCVSMDYVPDRGRVLWSRWILSMLCLGQLISAFAVIGCHAIDFSEDTKLEIGVS
LGLLAFGNIFASGIVTGVLFFIRWKNEEVRAKSEGSEANHEAWICTKVALSLIGMAPISRYVELFAVYRRLTKLERRLDK
EQASAANSTSVQNRESLSQSPLPSVSLDPSQPNRDRERLNQLRRLFIQLDFDACVVGLANATLGAGPFAIAQGVLYFRRL
MLNRMMSNSTGGAILASFVFSLLWLTSTACQFQPDAHYLPPSQLLRKAAYQHDHLVSASGRILLFFARGFHLTIRMITFT
FFAGLFGWMLAVVVVVHALFYLIILMIYRGNRSLLSASYKPNPSYRRPLDQRLQSKGILRHLATDLLYTFVSIYDFFNGS
AGKTRLRVILYYFAYYLENASMIGAWYKNYPFTAAWYYLPILLVVVTVQWMGAIFLQLYFFYFSSSPRGTSLCGLCCPDE
LRGPIELVYSPVPTPTKIPAVQRAQPLSPPRDNPSFILQPTSLYSCRSPYDQRGSFSSHPRTAKTDSLTVVTAELPKKPR
SKYLYVKNVEDEEPTEYWNEWQGVEVTVVGGGSDV