TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5BTU3|V5BTU3_TRYCR Carrier protein OS=Trypanosoma cruzi Dm28c GN=TCDM_03299 PE=3 SV=1
MYGPGLITQNEVPIENYNVSNTSLHAVTLHTTEIGPHEHTNSVNRSYSDLNSLQFLLYAAVFCWIRTALQQPLNLALARQ
QTCPIAGSMTTMQIVRYVYGAEGGMRGLMQGMFALTLGCALSEALYLWLFEYSRERLPMKSEATRDAVSGYVSDAVCRLI
HLPLSIVALRQMTANKMMVGGTYKTSGIFRTILLMYRENGMRTVFAGYGTTLLVGCQWTAVWWAMYGYTKGWLYEAADGF
LEADNQDNLNLSASSFSSWKHWLLAKDDNIVLNSVSSLVTSASTAVLFNPYLVVRANLQVKPKARLWGVVRDVYRTQGMR
GFYVGLALNIGTCLIDGVLASTSYEYAKLWADKSHHRQNHSE