TCDB is operated by the Saier Lab Bioinformatics Group
>tr|V5H5N4|V5H5N4_PHOLE Putative membrane protein OS=Photobacterium leiognathi lrivu.4.1 GN=PLEI_4003 PE=4 SV=1
MSLLESLGKKLEPIMLFMGLVSPIATMPQLYKLFISHPNHAHGLSLTTWSMYALISLLWFIYGLYHKNPTIWVGNFLGFL
AYFAMMVGIVMKAGVTF