TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W0H3Q2|W0H3Q2_PSECI Uncharacterized protein OS=Pseudomonas cichorii JBC1 GN=PCH70_06910 PE=4 SV=1
MSALLERLITDDTTTADPVTDEAAKAPELFFDVSSGNDTEVQRSPGLILTKQQIVNLKQYELAGLALPIELEGVIAYLGY
SSGAGAGLEPEDFLKSYKIVHTHARRWSPLRSQLLTVGSKLKLFAGQMVIYGKSMEDIYNDIKGGVIVEKFDIKTLEDVK
RLTRELGDKFPGIELSESDKEAAKDIGFYLGEILRKVKENQADAQDIKEELEKFGQDLALYVTPEIQRKVTAIDNSSLPA
DVTKLNESIERRAKDIDEKNKEYKAAVEKSLGAVGKLNIVGLALGIYFGVEAEGVRKARNELITQQDKEINELQQKNKII
GSLSRVKFDLQNLVTVVIDADIATKNLITVWNKLFIFIEESAQSSTEINDALSLRVFMNRFRKVVQPWKTIEQDSDALLN
VFKEADDEFKRIYGK