TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W5KMN2|W5KMN2_ASTMX Uncharacterized protein OS=Astyanax mexicanus GN=PRF1 (3 of 7) PE=4 SV=1
MLQAVLFWVVLAAVLPPPTCQSCFQGKAAQCQKADFAPGSDLAGEGFDITKMQRKGAFVIDMSTWMTKNKTCTLCKNPYM
EGKKQKLPRSVVDWRPSQKCSMKVSSSVYQTSESLLSSSTSSIDNNWKAGLGIDAVKGAGSLMLAGSNSKLAKYSMEKTK
KDKFSFTSHSVSCGYYRYRVSGHPLVHPELKFELRKLPKRYDNKTKQSFYKLIDKFGTHYITKVTLGGAVHAVTSIQQCQ
AALQGLNVDEVKTCLSVEASVSVVGKVSSTSAYEHCRRFEEKSLQKKSFSSSFTDRLTDVIGGHTENAELLFSADKDPAA
YKEWLSSLPKHPEILSYSLDSLHELLPKKKPMREHLRNAIKDYILQRGLLKNCSKPCKAGIKTAPKEPCICSCHNNKGVN
CDCYPTRRGLAQIIVTAVRATGLWGDYFT