TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W5Q669|W5Q669_SHEEP Uncharacterized protein OS=Ovis aries GN=SLN PE=4 SV=1
MERSAREICLNFTVVLITVILIWLLVRSYQY