TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W6UD82|W6UD82_ECHGR Transmembrane and ubiquitin-like domain-containing protein 2 OS=Echinococcus granulosus GN=EGR_06325 PE=4 SV=1
MKWLNASEGGFRLIWEQKEFIEGIGNEVLICALSLGGILLCVGFRLYSHGFRILSPTSNTHNQSMNSNSDVVESTENADS
DEGAVAYHTGVLDTDYMESLRDINHHLDTDVSEAEASSMGKTREDNERELRAARAQGNIVLRLQYLNDRVRYVHAPPEMP
VLLFKRKFFADELERQHKSVRLIFQGRELKPPAVASRDSPSRRRLCDYGVSDNATIHCLISDAPPHPTPSSSSTPADRIA
SATGSVLRPNFSAPEDLDFGSHAMMPLFAFLLTSVWIFRFAHAEYFSLVSTVALVCLSALFAGAVFSSATVNRRRTAERS
SVAAGDAIQTS