TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W6UPY1|W6UPY1_ECHGR Oligosaccharyltransferase complex subunit OS=Echinococcus granulosus GN=EGR_01333 PE=4 SV=1
MDWVFCSIFTFLECPRLRIKRPSWLQLPSRMTVFAFVLSTYFLVTGGIIFDVINGPPSVGTETDARGNQRPLQVAFMQWR
INSQYIMEGLLCSFMFTLGAIGFILLDIINESKMTRLARAVVLSLGVACIFVSFISVRAFMKIKMPSYRF