TCDB is operated by the Saier Lab Bioinformatics Group
>tr|W8FYS5|W8FYS5_9GAMM Uncharacterized protein OS=Thalassolituus oleivorans R6-15 GN=R615_13755 PE=4 SV=1
MLLTAKILVTFSTVLLLSWIASRSGPKLAGLMSGFPLGSAISLYFIGMEQGADFAAIASIHSLGGLTSSLCLAGAYWWTM
TRFPSVKYLPLVLVVSLGAFIVSAWVLQFLPSEREVNLAAVVAAIILFRLWFKQIPAASIVKPRQGVWLKSWFTLLFRAA
VATAAVLLVTGLASILSPTQAGLLAAFPISFFPLMLILHISFGAPMLASTIRHYPDGMGALVIYVLTIGYTYSTVGVALG
TAIGLLCSILYLATYALFSRHLQRKG