TCDB is operated by the Saier Lab Bioinformatics Group
>WP_002265438.1 DUF4956 domain-containing protein [Streptococcus mutans]
MLNQIFNSVFSNRDITISPIMFALSILTSLLLGLLLAKIYKYKTIYTKEFIITLATLPVLISMIIFLVNGNLGTSVAVAG
TFGLIRFRSAAGGAKEILYIFFATAVGIATGMGFLVLAILFTLTLTLVLWLYENSGFSQVSTSRRQATFIVPNNEIDYIP
ILEKILNKTCREINLISVKNINKNNTIQMEYHLDLKPEMNDIGLINSIMTYNPDIEVTLDTSAKKKKIL