TCDB is operated by the Saier Lab Bioinformatics Group
>WP_013782198.1 ABC transporter permease subunit [Mahella australiensis]
MIKHVASYQWLRTRRWWLCPAVIAVCALMGIFSIMSARSQDATTGMDFIYESTTFLTVAMFIISAAAALAINREADEDSA
DILWALPVDNASMIFGKFMGIFPLVLASAAAYWLPHAVMITVKWAGSGLSIWYLAGELGFAALLQGAGMVSAAAAGAALG
LILRGFWLYGTVIALWMGAFASTITSIWPLYESAPQEHIYKIMFRQLIDWILNGPMMMPNQMPRDLYTTVLYPGILWQRV
FYIALALFIAALAAVLIRRRRAAGRAKMVLRTTLSVSLALVICSAAVFFYEQGYGYRKYRDEMAFYDEYYGHFYSNKQPS
ANAVELPSADYLAEMPLYIDSYDLDVDVTKPPVLSVKAALNLRNVGDDTMENPLITLWHGFNVTSASADGKKLTAKRVGD
GVYLEGLSLNAGASAHIDMEYTGSAEWWGIYYLHPRLNAFTDKYGFILPADYGWYPLTVPLPLMKTTDSGGFSENGWGVS
LTGVSQIVPLGLTNEMDEKSPATNGNIDPWQRQSYFTVTVHKDNASPVVSSIGEAQNPCEKDVRIAGKGHYLTLICWPLE
RVDVDGSALYRPPEYKGDEGKYPVTVMNDTWKWFGISGRKAVGVIMPPFNGDRYMPELVDGAQGFYMAAREAMGYEQDFF
YGVMTGRAQNGGSGEYILYAIYPEWRKWKYTGSYDVEDIKGYIEDIDGFSISDADKIMKWFASHDDAAAQATLHELYMKA
QKQPLSVEDIKEAFGL