TCDB is operated by the Saier Lab Bioinformatics Group
>WP_013865829.1 phage holin family protein [Microlunatus phosphovorus]
MADRKVADLIKDIRGDAQLLVNDQVELAKSELAPAAKNAGIGGGLFGAAGYFGINAGTLIFVAAALGLAALGLPYWAAFL
IVAAVLLIIAGILGAIGYSRIKKVKPPEKTIANGKALVTELQAAVSRATAAATAPRIEGTVANDKKALR