TCDB is operated by the Saier Lab Bioinformatics Group
>WP_022859683.1 hypothetical protein [Bifidobacterium magnum]
MQTLKHWGVWITEAAISGVPMIPLFIFVTSFIAHEGAFTYVLPFVLFYAFNKMGEFTLGIFGEVNNPYRLAQISAWIVIV
GAVVCWFGHLSIICYDISGILIGFGSSIFGTMYRTVKSEMLKLGRFPYQHANLMGFAIMTIFSFLILGAQGKLETTIIAV
YIAMAVIALLTLQGFKVDQDAKNRSLFQPHTGDIRYGIPALLMLLIAFFVRLFKQTAGAADIIVIMVLAAIIMVVVNVFT
KYLPKQAFNYHGVYYNEVLIMVVLFNVFYYIACNNIPAVLLINGLQFLGQFIAMIAGAKVINALQDRNIKHILTLGMIIA
LAVFAIPNTITDAIAVLAIGFLSQTGDALVSGTFRKQSQLSDVDAALSSQKTIGTGIVAGQTILVIVLALVSLFVLHNDA
TAMSAYAFHMDIAHVDTAFLYTRWICAALIAVQGAIMFLRNHPGADREPHVTGATA