TCDB is operated by the Saier Lab Bioinformatics Group
>WP_031549744.1 hypothetical protein [Parvularcula oceani]
MSFKNARRALSVIGQEQALRTRLFAVSHLLAGNFGAAGLSLLTTAFAARTLGPAAYGTLALVTVYVQTIERLLSFQTWQP
LIRYGAEAERAQDSADFRTIVKFAFLLDLSTAVGGFALAVTLALMGQSLFGWSEEISRYAVVYAATLLIAINGTPVGVLR
LAGRFRAVAYVQVVTMSLRVVLSALGYLLGWPLMAFVLIWASTQALGAVLLLAAAGRELAARQCLGFLREPMVGLRQRFP
GIWRFSLVANFGLTLRASSQQVDVLLVGAIIGPAAAGFYHIAKRVAKFAEQAGGQLQVVVFPELARLWAAGERAAFRRAV
VQSEILIAAACVLGVGFVLVVAEPAIVLFAGNSFAPAGSLLKVQIVAIALFLCGTIARSGLLALGRETEIFWISLAGAGV
FFAAAPLLLPRMGAMGANVAHVLQGLVWLISLSAAFLLALRRTERAAGPGPG