TCDB is operated by the Saier Lab Bioinformatics Group
>WP_033917854.1 hypothetical protein [Enterococcus faecalis]
MNKKIESLGNTALSLLSNTIIVVPYLLYIQLSDGHNLLTILPFVLFYTLRMTGIFLVRGINLSLTSLGLLKISLLLGLAG
SLIGIAGAFSFPLYSISGMLLGLSGALLPPSNQSIRFFLKEEGQKISHSNLLTTVLLTAVLFGALFFKATEIGLALLVYA
LYFLVALVAIKSYPVSLNELEEESAEVSRKELILFVIFFVLLLLLRSGRLLTNAVEFDYAIVGACCFFVVAVLFVSHYGK
RGAYKVSLEMNLATLINGIVGNYLFLFGSIYVAGVYGRAHMGIYLYLPYVLGMIFAMIVASKTKQWSNNIPMIGLAGSLG
ILLLTSWTILGLFLLSFFKSTLNSFLARRYYQETDLPKDSRILIKYTTQTKGSLFHQFILMALMLVTVVGKGGTTQFLLE
LTGGKGISTQTSQFLTFIKNSNSLLVLLFIAVYFVVVFRQKKR