TCDB is operated by the Saier Lab Bioinformatics Group
>WP_035064856.1 hypothetical protein [Carnobacterium maltaromaticum]
MIKAIRKFNIRLPFFTSILIKSFHPFVILMLTHLFINHRSKSFLLPLIFYYSIKSSVLFIFRSNPVQVTKLFKYSVFIGI
IGCLMAFISNESIFIYSIAGILMGICSGILIPSYATLKRTSLTQSINSPSLKWKIGGILCSILYLISLAKLIQLNSAIVF
IVLGIALIWLYQHQSENLVFDVKNKNDYPEYAIFESLFLFIVIFASVFVLKEDKKEGITNLLPGLICTIFIIMIFYSIYR
YKKHPERRISFKLSSVIIYKGMLTNFILAFLTFYQVIKNGESELMVIYYIYLVGMLVKGAFISFLKKIFYGISEQQLIMT
GLLVSFIFLLFQPTFYVGILCLSLFVSELNSELDQYVYNHVDLPKDFRLIAKARLTNIGSVINQLIMFTTLYIAALYTNT
TVLNVLKAYHSQKESLDFLSVLNVTKNSMLVVFVIYLYGLQKILRKVTTINNE