TCDB is operated by the Saier Lab Bioinformatics Group
>WP_044267152.1 hypothetical protein [Bacteroides timonensis]
MQMIDLIRKVLSNRVLLYVSSRYFVYALQFLLLIVIATKLGVTNYGSWGFFLLLLSYCNIINFGIANSVSYFLIQNKNNK
LLTRYYASASYILIAVMVIISFLFFIVSFYIAPTLFTKYHILDKIIFLSIIAAIQYVNTLFSNIYRVKNRLLELAIYQSS
IPFCMLIAIVVSPHNLLFDFLIYSYLIAHLFSLLIFIFRGQLPKFSLVPIIYIKQLLKKGFFLFVYNSCFYLIHSTTSLV
ISIFYSVDDYGLYSFSYSLGHSILLLLEAFTFVVFPKLVDKFYSAKKEEFSLLISIVRNNYIKLSHLLMYFALLCFPVIT
FFFSQYSGALQAMYITSLSILISTNAFGYNTLLLAKNYEKSISKVSILSLLLNVFIVVLIATVFKLSFVYAVMSMMIVYY
TFSLGCIILTNKMFNLKFSVFCIFNEAFEWELLIPFIIALAFALMQCYSLMFIPIIFFVILNYTSIKEITISIKRVIFRP
NIIDIN