TCDB is operated by the Saier Lab Bioinformatics Group
>WP_047253868.1 hypothetical protein [Corynebacterium testudinoris]
MANAAAETTTAAPKPVTESGLFDSWIGLSSGFEFEGEKYPTIVSYVFNFLKNAGDWAGAVNSLIGLVN