TCDB is operated by the Saier Lab Bioinformatics Group
>WP_048050534.1 hypothetical protein [Methanosarcina soligelidi]
MSQNIKDVMDIRDIKIKDLTANPAPLGLMGFGMTTVLLNIHNAGFYPMNSMILSMGFFYGGLAQIIAGIQEWKKGNTFGA
TAFTSYGLFWLTLVGIVLLPKSESYAGLATESFPFAAYLFMWGVFTLFMFIGTLKGSKALSVVFFTLTILFFLLAAGNYL
GSESILVIAGYEGILTGLSAIYAALGQVLNEAYGKKIVPL