TCDB is operated by the Saier Lab Bioinformatics Group
>WP_051881578.1 hypothetical protein [Parvularcula oceani]
MPNLENFLTYEHWQYELVRHLFTLTVACFAAGFVYFVLSMRNTAPWYRISSVLSAVVMVSATYEIFQLFTSWQSSFESVP
TSPAGASVLPGIEAGGINAYVPVADTMFSNGYRYINWSIDVPMLLTQLLVVVGLTGAAFWSNWWKLTLAGLVMVYTGYIG
QFWEPQVAGLTEGRNSYPFWVWGFVSTLPFIYINYKVMTLTHNMVGEVPDRARKEMGRIGIFLVATWTLYTIGYVLPAIW
PTNDGMVFRQFIYTTADITSKLVFGIMLSRVALIRSAYDGFEPAIKARQGIVFGRPSVDVRPHFGTTAPRDTIRQSESDA
R