TCDB is operated by the Saier Lab Bioinformatics Group
>WP_054649096.1 hypothetical protein [Desulfovibrio brasiliensis]
MTKHSTTPRPNPRAAAGGAALGATLFGAVVGGAAAAAGTLGKVKSGEMTKQEAARTVAREAGTTGIAAGAAVGVAGALGL
GGILSFVGIVAVATGTKYALDSALNPAPAQAPEKVAAKATAKTARKKPAKDASKKASAKPAEKTSARKSTKDSAKKTTKK
TDTDSSDPVQ