TCDB is operated by the Saier Lab Bioinformatics Group
>WP_068621973.1 hypothetical protein [Trichococcus ilyis]
MFETCYFLLGTANSLLLTTIFLLVRYAKASRVAAAGKVYLALAVPAGILIALAQQQQIPVQYTIFLSIFLVFLALEGIYD
FVLKVSFRDNWKLLTPYLMLYWSLNYGFIVLAWRHSNVQGGFLLGLFVLQIIANIRSHTKETEK