TCDB is operated by the Saier Lab Bioinformatics Group
>WP_069116643.1 hypothetical protein [Spiroplasma helicoides]
MKKYTNNLLIYKILFAVLSIIAVYGQWVYKLIDNSNYGSDTQLMYHGNNELATIEHFTTFTLLSNIFCQVWFINASINCK
KEGLTKGTSYTSAMTLSILITITCLVYNLVLTPVSGFPKDIVGVLCSIMNHIIMPIAFVCYVIFLMPRKRKVNLNLFFTK
KFWIPFTIILSYCVMAMAKGELRWSSMDRSIYEYVDSLGKNKDIYYPYFFLNIHKDQFGLPGYAIFILTFFGVFGLMVGI
TYLYNYANNKIVEKKYYQYLNEYDVEVTEVKAQSEQK