TCDB is operated by the Saier Lab Bioinformatics Group
>WP_071499863.1 hypothetical protein [Exiguobacterium sp. KRL4]
MSLIFLICSQVFGLALGLIKSLVLPIFLSIEDFAFWQIYLLYTGYIAVFSFGFNDGLLVRYGKYDFNKLPLNLVGRSIKY
FMFFIIALTSFIILISLLIPYNDKTLLFIFITLNIPLVVLNGIFLFLLQSTNQIKKYSVYSVIDKFIVIITIFVFIYLDI
KNIYVIIMVDMASRFIQILLMYIEFYKLFKPEGDNKSTRKIISEIQKNISRGSYILITNLIGMLLFGYGLFVIERFMSLK
DYSLFSLGISTTNILLLFINAVSIVVFPYLSRLENNQVFSKVTQINFLTTHFSIFICNIYIIIVFILENYLEKYSDLLIF
LPFIFLSVVLQIKFNIILYPTIKLLKREKIIFKINLKLLILSIIFTSLSIIYYHSLLYAAITMYIVLYLRNYVLGKLISK
DTKDIKKVKYLELLSHIIFITIVLFFENKFYLYTIYSIFILIIDAKKIVLRGKFI