TCDB is operated by the Saier Lab Bioinformatics Group
>WP_073593693.1 TonB family protein [Phormidium ambiguum]
MSISSFCLEQREKEKAALKSILTYSIAGSAALHLLLAFGFALFWPEQPSLADDPIEIVVLDAPEPEPEIKKPELETPKPT
PQPVVTPTPEKVVVTPTPEPIPSFTPEPIPSFTPEPIPTPKIDTPPTKVEAPKPLETPEEPKEINEPIKTPTPPEPEQVA
EKLPPPRIAEPPKEELQKPDPQPPKPETETANTPQPLATPFANARDFKDSLAESQPVENEIKTEETPQLPGGLTANQQPP
VNNSTITSQPLESPRTANREFRDTANATLRDRIAATNNAMTSTNPSEDTSVMNPGIPGEVTTNRENSPTKPTVTSQPLQT
SPSRNRAFRDSFANSNNSPINPNPQSDLSAGSPGVPGEVTANNQRPNNRPVGGSKPLQTATNNRGFRDSFSNNNNTSTNT
TDSNISPTIPGNSTGVAVNQPPARRNTRQEGENTGGNRRTARRSGRGGGLRCVSDCTPDYPSDVENLEGRPVVQFVVEAD
GSTANPQLAESSGNSKLDQAAVEAVRKMRFAPPDEGQRTVKLAINFATSGSDFERQARQRREENERQRRERERQRQESLD
TEN