TCDB is operated by the Saier Lab Bioinformatics Group
>WP_081871344.1 hypothetical protein [Parvularcula oceani]
MTARDTTAAMAPRKPLLQRAFNSSSALVGSVIVQAVLRFGSNLILTRLLYPEAFGVVLVITSVTYVMALLAETGIPAFLV
RTKPALERRYYDTLWTVQVLRGAVLAVALALLAGPIAGWLGKPALELPLRAASVIFFLDGLKSLAPLRERRNRRDWHNSL
TEMGTYALQLPIIIGLAAWLESYWALIYGMIIGAALTSASTYIFYGSSWHRPRLDGAVVKELWIFSRFLAASSVITIVLN
QFDKFFIAGNMSLAIAGLYNMAWSLAFVADGLVRSYSHRIFYAELAHSLEGSELSRAAYYRPMRRMRPLLAFACAGGITF
GETFFAIAFDDRYLEAGAMFAILSFRPLLALFARPGENAMLAIGRPRTKFVSDVLKLAWLIGTALIGYNLYGVYGLIWAT
ALVDIPAVLYFSVLLRKAGTFSLREEVWTLLFVAVGLGCGAVGTWVWEGTHRAALY