TCDB is operated by the Saier Lab Bioinformatics Group
>WP_093117683.1 hypothetical protein [Thermoleophilum album]
MAEAFFAQAAPSAGGAPLDQLAVLAAVYWGGSAAVIATCVRYRRGKARPLRVAGRVVGRLFGLPGWSALPVAIATVGLLA
AMWGGMWDIGYHIDQGRDTGPLGNPAHYPMLFGIFAAFAAGVLALGTADQRDRGPAWVLAGGGRRGPLGGALLAAAMLFA
LAALSLDDVWHRIYGQDVTLWSPTHFVFLFFGVLSVVGMLVLVQEGAEARAKRASAGVAGRDESRAVAPTLAGARRWARW
FGAAQRATLLGGLLCGLELFLAEYDYGVPLYRQVWQPLVLALAAAFVLVAARAWVGRGAALGAATAYVAVRGSASLFAGA
MGVHTPTLPLFFAEALAVEVVGSLLLSRRAVPAPTRTVGFGAVAGVVSAAAGFAAGYGWSRVAMPLPWTTALLPEGFLLA
LLGGCAGGVLGALFAASLRGALPRPALARAGFAGAAALAVGACVAASLRTVPDAVARVELRPVAGSSGEAYVVARLSPAA
IAAQPNWLYVLAWQGRRDRVVAPMARAADGSYRSTSPVPLAGTWKAALRLNAGRVRGAVPLRLPADAGLDGSRRSLPVSF
TRSQLERAMRDAAGAALPAAPVFTRAFVGDEWIFLREARGVPPWLWQAGLATVLGAWAAMALALALSLGRLGRRFEARGG
MSSGARPAGRGQLRHAAAQAT